Lineage for d1g7kc_ (1g7k C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547242Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 2547243Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 2547250Domain d1g7kc_: 1g7k C: [38373]

Details for d1g7kc_

PDB Entry: 1g7k (more details), 2 Å

PDB Description: crystal structure of dsred, a red fluorescent protein from discosoma sp. red
PDB Compounds: (C:) fluorescent protein fp583

SCOPe Domain Sequences for d1g7kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7kc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
qygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d1g7kc_:

Click to download the PDB-style file with coordinates for d1g7kc_.
(The format of our PDB-style files is described here.)

Timeline for d1g7kc_: