Lineage for d1g7kc_ (1g7k C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31413Fold d.22: Fluorescent proteins [54510] (1 superfamily)
  4. 31414Superfamily d.22.1: Fluorescent proteins [54511] (1 family) (S)
  5. 31415Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 31446Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 31447Species Coral (Discosoma sp.) [TaxId:86600] [54516] (2 PDB entries)
  8. 31454Domain d1g7kc_: 1g7k C: [38373]

Details for d1g7kc_

PDB Entry: 1g7k (more details), 2 Å

PDB Description: crystal structure of dsred, a red fluorescent protein from discosoma sp. red

SCOP Domain Sequences for d1g7kc_:

Sequence, based on SEQRES records: (download)

>d1g7kc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.)}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
xskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfigv
nfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkpv
qlpgyyyvdsklditshnedytiveqyertegrhhlfl

Sequence, based on observed residues (ATOM records): (download)

>d1g7kc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.)}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
skvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfigvn
fpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkpvq
lpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOP Domain Coordinates for d1g7kc_:

Click to download the PDB-style file with coordinates for d1g7kc_.
(The format of our PDB-style files is described here.)

Timeline for d1g7kc_: