![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) |
![]() | Superfamily d.22.1: GFP-like [54511] (2 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (2 proteins) |
![]() | Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species) |
![]() | Species Coral (Discosoma sp.) [TaxId:86600] [54516] (2 PDB entries) |
![]() | Domain d1ggxd_: 1ggx D: [38370] |
PDB Entry: 1ggx (more details), 1.9 Å
SCOP Domain Sequences for d1ggxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggxd_ d.22.1.1 (D:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.)} vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp vqlpgyyyvdsklditshnedytiveqyertegrhhlfl
Timeline for d1ggxd_: