SCOP 1.59: Domain d1ggxd_: 1ggx D:

Lineage for d1ggxd_ (1ggx D:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)

6. Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)

7. Species Coral (Discosoma sp.) [TaxId:86600] [54516] (2 PDB entries)

8. Domain d1ggxd_: 1ggx D: [38370]

Details for d1ggxd_

PDB Entry: 1ggx, 1.9 Å

PDB Description: red fluorescent protein (fp583 or dsred(clontech)) from discosoma sp.

SCOP Domain Sequences for d1ggxd_:

Sequence; same for both SEQRES and ATOM records:

>d1ggxd_ d.22.1.1 (D:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.)}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

Timeline for d1ggxd_:

• d1ggxd_ first appeared (with stable ids) in SCOP 1.55
  
• d1ggxd_ appears in SCOP 1.57
  
• d1ggxd_ appears in SCOP 1.61
  
• d1ggxd_ appears in the current release, SCOPe 2.08