Lineage for d1ggxc_ (1ggx C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190674Fold d.22: GFP-like [54510] (1 superfamily)
  4. 190675Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 190676Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 190720Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 190721Species Coral (Discosoma sp.) [TaxId:86600] [54516] (2 PDB entries)
  8. 190724Domain d1ggxc_: 1ggx C: [38369]

Details for d1ggxc_

PDB Entry: 1ggx (more details), 1.9 Å

PDB Description: red fluorescent protein (fp583 or dsred(clontech)) from discosoma sp.

SCOP Domain Sequences for d1ggxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggxc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.)}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOP Domain Coordinates for d1ggxc_:

Click to download the PDB-style file with coordinates for d1ggxc_.
(The format of our PDB-style files is described here.)

Timeline for d1ggxc_: