SCOPe 2.08: Domain d6nbea1: 6nbe A:1-146

Lineage for d6nbea1 (6nbe A:1-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (13 PDB entries)

8. Domain d6nbea1: 6nbe A:1-146 [383686]
   Other proteins in same PDB: d6nbea2, d6nbep_
   automated match to d3w3da1
   complexed with atp, ca, coa, gol, lab, mes

Details for d6nbea1

PDB Entry: 6nbe, 2 Å

PDB Description: ternary complex of ac-alpha-actin with profilin and coa-naa80

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6nbea1:

Sequence, based on SEQRES records:

>d6nbea1 c.55.1.0 (A:1-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
xedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
qimfetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d6nbea1 c.55.1.0 (A:1-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
xedettalvcdngsglvkagfagddapravfpsivgrprhqmgqkdsyvgdeaqskrgil
tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe
tfnvpamyvaiqavlslyasg

Timeline for d6nbea1:

• d6nbea1 first appeared in SCOPe 2.07