SCOPe 2.07: Domain d6mqte1: 6mqt E:1-166

Lineage for d6mqte1 (6mqt E:1-166)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (155 PDB entries)
   Uniprot Q6P716

8. Domain d6mqte1: 6mqt E:1-166 [383684]
   Other proteins in same PDB: d6mqta2, d6mqtd2, d6mqte2, d6mqtf2
   automated match to d2q21a_
   complexed with gdp, mg; mutant

Details for d6mqte1

PDB Entry: 6mqt, 1.5 Å

PDB Description: hras g12s in complex with gdp

PDB Compounds: (E:) gtpase hras

SCOPe Domain Sequences for d6mqte1:

Sequence; same for both SEQRES and ATOM records:

>d6mqte1 c.37.1.8 (E:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgasgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d6mqte1:

• d6mqte1 is new in SCOPe 2.07-stable
  
• d6mqte1 appears in the current release, SCOPe 2.08