Lineage for d1ggxb_ (1ggx B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190674Fold d.22: GFP-like [54510] (1 superfamily)
  4. 190675Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 190676Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 190720Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 190721Species Coral (Discosoma sp.) [TaxId:86600] [54516] (2 PDB entries)
  8. 190723Domain d1ggxb_: 1ggx B: [38368]

Details for d1ggxb_

PDB Entry: 1ggx (more details), 1.9 Å

PDB Description: red fluorescent protein (fp583 or dsred(clontech)) from discosoma sp.

SCOP Domain Sequences for d1ggxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggxb_ d.22.1.1 (B:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.)}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOP Domain Coordinates for d1ggxb_:

Click to download the PDB-style file with coordinates for d1ggxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ggxb_: