Lineage for d1ggxa_ (1ggx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547242Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 2547243Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 2547244Domain d1ggxa_: 1ggx A: [38367]

Details for d1ggxa_

PDB Entry: 1ggx (more details), 1.9 Å

PDB Description: red fluorescent protein (fp583 or dsred(clontech)) from discosoma sp.
PDB Compounds: (A:) protein (fluorescent protein fp583)

SCOPe Domain Sequences for d1ggxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggxa_ d.22.1.1 (A:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d1ggxa_:

Click to download the PDB-style file with coordinates for d1ggxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ggxa_: