Lineage for d1c4fa_ (1c4f A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184486Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2184492Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
    Uniprot P42212
  8. 2184678Domain d1c4fa_: 1c4f A: [38365]

Details for d1c4fa_

PDB Entry: 1c4f (more details), 2.25 Å

PDB Description: green fluorescent protein s65t at ph 4.6
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1c4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4fa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d1c4fa_:

Click to download the PDB-style file with coordinates for d1c4fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c4fa_: