Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (4 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries) Uniprot P42212 |
Domain d1c4fa_: 1c4f A: [38365] |
PDB Entry: 1c4f (more details), 2.25 Å
SCOPe Domain Sequences for d1c4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4fa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt tfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi
Timeline for d1c4fa_: