Lineage for d1c4fa_ (1c4f A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132152Fold d.22: GFP-like [54510] (1 superfamily)
  4. 132153Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 132154Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 132155Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 132156Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries)
  8. 132187Domain d1c4fa_: 1c4f A: [38365]

Details for d1c4fa_

PDB Entry: 1c4f (more details), 2.25 Å

PDB Description: green fluorescent protein s65t at ph 4.6

SCOP Domain Sequences for d1c4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4fa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsynvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOP Domain Coordinates for d1c4fa_:

Click to download the PDB-style file with coordinates for d1c4fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c4fa_: