Lineage for d6okcb1 (6okc B:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916579Protein Beta-ketoacyl-ACP synthase I, N-terminal domain [419014] (2 species)
  7. 2916657Species Escherichia coli [TaxId:83333] [419574] (2 PDB entries)
  8. 2916659Domain d6okcb1: 6okc B:1-253 [383646]
    Other proteins in same PDB: d6okca2, d6okcb2, d6okcc_, d6okcd_
    automated match to d1fj4a1
    complexed with mrj

    has additional insertions and/or extensions that are not grouped together

Details for d6okcb1

PDB Entry: 6okc (more details), 1.55 Å

PDB Description: crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabb, and c12-crypto acyl carrier protein, acpp
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d6okcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6okcb1 c.95.1.1 (B:1-253) Beta-ketoacyl-ACP synthase I, N-terminal domain {Escherichia coli [TaxId: 83333]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d6okcb1:

Click to download the PDB-style file with coordinates for d6okcb1.
(The format of our PDB-style files is described here.)

Timeline for d6okcb1: