Lineage for d1yfpb_ (1yfp B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190674Fold d.22: GFP-like [54510] (1 superfamily)
  4. 190675Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 190676Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 190677Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 190678Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (27 PDB entries)
  8. 190712Domain d1yfpb_: 1yfp B: [38363]

Details for d1yfpb_

PDB Entry: 1yfp (more details), 2.5 Å

PDB Description: structure of yellow-emission variant of gfp

SCOP Domain Sequences for d1yfpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfpb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagi

SCOP Domain Coordinates for d1yfpb_:

Click to download the PDB-style file with coordinates for d1yfpb_.
(The format of our PDB-style files is described here.)

Timeline for d1yfpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfpa_