Lineage for d6nhrb_ (6nhr B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646074Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [376251] (6 PDB entries)
  8. 2646075Domain d6nhrb_: 6nhr B: [383618]
    Other proteins in same PDB: d6nhra1, d6nhra2, d6nhrc1, d6nhrc2, d6nhre1, d6nhre2
    automated match to d4d00d_
    complexed with bma, man, nag; mutant

Details for d6nhrb_

PDB Entry: 6nhr (more details), 2.1 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha2 i45f mutant
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6nhrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhrb_ h.3.1.1 (B:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaafdqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d6nhrb_:

Click to download the PDB-style file with coordinates for d6nhrb_.
(The format of our PDB-style files is described here.)

Timeline for d6nhrb_: