Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [376251] (6 PDB entries) |
Domain d6nhrb_: 6nhr B: [383618] Other proteins in same PDB: d6nhra1, d6nhra2, d6nhrc1, d6nhrc2, d6nhre1, d6nhre2 automated match to d4d00d_ complexed with bma, man, nag; mutant |
PDB Entry: 6nhr (more details), 2.1 Å
SCOPe Domain Sequences for d6nhrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nhrb_ h.3.1.1 (B:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaafdqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d6nhrb_: