SCOPe 2.06: Domain d1b9cd_: 1b9c D:

Lineage for d1b9cd_ (1b9c D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d1b9cd_: 1b9c D: [38361]
   mutant

Details for d1b9cd_

PDB Entry: 1b9c, 2.4 Å

PDB Description: green fluorescent protein mutant f99s, m153t and v163a

PDB Compounds: (D:) protein (green fluorescent protein)

SCOPe Domain Sequences for d1b9cd_:

Sequence; same for both SEQRES and ATOM records:

>d1b9cd_ d.22.1.1 (D:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d1b9cd_:

• d1b9cd_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9cd_ appears in SCOPe 2.05
  
• d1b9cd_ appears in SCOPe 2.07
  
• d1b9cd_ appears in the current release, SCOPe 2.08