![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) |
![]() | Superfamily d.22.1: GFP-like [54511] (2 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (2 proteins) |
![]() | Protein Green fluorescent protein, GFP [54513] (1 species) |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries) |
![]() | Domain d1b9cd_: 1b9c D: [38361] |
PDB Entry: 1b9c (more details), 2.4 Å
SCOP Domain Sequences for d1b9cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9cd_ d.22.1.1 (D:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)} geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
Timeline for d1b9cd_: