Lineage for d1b9cc_ (1b9c C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190674Fold d.22: GFP-like [54510] (1 superfamily)
  4. 190675Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 190676Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 190677Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 190678Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (27 PDB entries)
  8. 190718Domain d1b9cc_: 1b9c C: [38360]

Details for d1b9cc_

PDB Entry: 1b9c (more details), 2.4 Å

PDB Description: green fluorescent protein mutant f99s, m153t and v163a

SCOP Domain Sequences for d1b9cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9cc_ d.22.1.1 (C:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOP Domain Coordinates for d1b9cc_:

Click to download the PDB-style file with coordinates for d1b9cc_.
(The format of our PDB-style files is described here.)

Timeline for d1b9cc_: