Lineage for d6ljsa1 (6ljs A:0-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804863Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2804864Species Human (Homo sapiens) [TaxId:9606] [110275] (37 PDB entries)
    Uniprot P15090
  8. 2804895Domain d6ljsa1: 6ljs A:0-131 [383593]
    Other proteins in same PDB: d6ljsa2
    automated match to d5bvqa_
    complexed with edo, ehr

Details for d6ljsa1

PDB Entry: 6ljs (more details), 1.75 Å

PDB Description: crystal structure of human fabp4 in complex with a novel inhibitor
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d6ljsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ljsa1 b.60.1.2 (A:0-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d6ljsa1:

Click to download the PDB-style file with coordinates for d6ljsa1.
(The format of our PDB-style files is described here.)

Timeline for d6ljsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ljsa2