Lineage for d1b9cb_ (1b9c B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132152Fold d.22: GFP-like [54510] (1 superfamily)
  4. 132153Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 132154Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 132155Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 132156Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries)
  8. 132190Domain d1b9cb_: 1b9c B: [38359]

Details for d1b9cb_

PDB Entry: 1b9c (more details), 2.4 Å

PDB Description: green fluorescent protein mutant f99s, m153t and v163a

SCOP Domain Sequences for d1b9cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9cb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOP Domain Coordinates for d1b9cb_:

Click to download the PDB-style file with coordinates for d1b9cb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9cb_: