Lineage for d1b9ca_ (1b9c A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255622Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 255623Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 255624Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 255625Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 255626Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (30 PDB entries)
  8. 255667Domain d1b9ca_: 1b9c A: [38358]

Details for d1b9ca_

PDB Entry: 1b9c (more details), 2.4 Å

PDB Description: green fluorescent protein mutant f99s, m153t and v163a

SCOP Domain Sequences for d1b9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ca_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOP Domain Coordinates for d1b9ca_:

Click to download the PDB-style file with coordinates for d1b9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b9ca_: