Lineage for d6wbdb1 (6wbd B:11-153)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790679Species Stenotrophomonas maltophilia [TaxId:522373] [383532] (1 PDB entry)
  8. 2790681Domain d6wbdb1: 6wbd B:11-153 [383575]
    Other proteins in same PDB: d6wbda2, d6wbdb2
    automated match to d1bbua1
    complexed with cl, edo, lys

Details for d6wbdb1

PDB Entry: 6wbd (more details), 2.05 Å

PDB Description: crystal structure of lysyl-trna synthetase from stenotrophomonas maltophilia with bound l-lysine
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6wbdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wbdb1 b.40.4.0 (B:11-153) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
denkliaerreklkalrgqgiaypndfrredfagrlqeefadaetwtaealegngrqvkm
agrlmakrimgkasfaqiqdesgriqlflqgavlgdaytafkgwdvgdiiaveggltrtk
tgelsvkaesirlltkslrplpd

SCOPe Domain Coordinates for d6wbdb1:

Click to download the PDB-style file with coordinates for d6wbdb1.
(The format of our PDB-style files is described here.)

Timeline for d6wbdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6wbdb2