Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Stenotrophomonas maltophilia [TaxId:522373] [383532] (1 PDB entry) |
Domain d6wbdb1: 6wbd B:11-153 [383575] Other proteins in same PDB: d6wbda2, d6wbdb2 automated match to d1bbua1 complexed with cl, edo, lys |
PDB Entry: 6wbd (more details), 2.05 Å
SCOPe Domain Sequences for d6wbdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wbdb1 b.40.4.0 (B:11-153) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]} denkliaerreklkalrgqgiaypndfrredfagrlqeefadaetwtaealegngrqvkm agrlmakrimgkasfaqiqdesgriqlflqgavlgdaytafkgwdvgdiiaveggltrtk tgelsvkaesirlltkslrplpd
Timeline for d6wbdb1: