Lineage for d1emea_ (1eme A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein Green fluorescent protein, GFP [54513] (6 species)
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (282 PDB entries)
    Uniprot P42212
  8. Domain d1emea_: 1eme A: [38357]
    mutant

Details for d1emea_

PDB Entry: 1eme (more details), 2.5 Å

PDB Description: green fluorescent protein from aequorea victoria, mutant
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1emea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emea_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
elftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttls
ygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnriel
kgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyqqn
tpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d1emea_ are not available.

Timeline for d1emea_: