SCOP 1.61: Domain d1f09a_: 1f09 A:

Lineage for d1f09a_ (1f09 A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)

6. Protein Green fluorescent protein, GFP [54513] (1 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (27 PDB entries)

8. Domain d1f09a_: 1f09 A: [38356]

Details for d1f09a_

PDB Entry: 1f09, 2.14 Å

PDB Description: crystal structure of the green fluorescent protein (gfp) variant yfp- h148q with two bound iodides

SCOP Domain Sequences for d1f09a_:

Sequence; same for both SEQRES and ATOM records:

>d1f09a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgyglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynsqnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagi

Timeline for d1f09a_:

• d1f09a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f09a_ appears in SCOP 1.59
  
• d1f09a_ appears in SCOP 1.63
  
• d1f09a_ appears in the current release, SCOPe 2.08