SCOPe 2.07: Domain d6wbda2: 6wbd A:163-499

Lineage for d6wbda2 (6wbd A:163-499)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:522373] [383534] (1 PDB entry)

8. Domain d6wbda2: 6wbd A:163-499 [383535]
   Other proteins in same PDB: d6wbda1, d6wbdb1
   automated match to d1bbua2
   complexed with cl, edo, lys

Details for d6wbda2

PDB Entry: 6wbd, 2.05 Å

PDB Description: crystal structure of lysyl-trna synthetase from stenotrophomonas maltophilia with bound l-lysine

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6wbda2:

Sequence; same for both SEQRES and ATOM records:

>d6wbda2 d.104.1.0 (A:163-499) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
qryrqryvdlivtpesravfikrskiiramrawldnrdflevetpmmhyipggaaakpft
thhnaldldlylrvapelylkrltvgglervyeinrnfrnegvstrhnpeftmmelyeay
atyneimdltegvirdvakavnggtevewdgakidlgpafrrwrmdeavrhhnpeisaad
ctdrdallrhcerlkirvkpsygwgkllleifeatvehtliqptfitdhpvevsplaran
dndpgytdrfelfvngkelangfselndpedqaqrfqaqvaakeggddeamhydadyira
leygmaptgglgigvdrlvmlltgsssirdvllfpym

Timeline for d6wbda2:

• d6wbda2 is new in SCOPe 2.07-stable
  
• d6wbda2 appears in the current release, SCOPe 2.08