SCOPe 2.08: Domain d6wbda1: 6wbd A:11-152

Lineage for d6wbda1 (6wbd A:11-152)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:522373] [383532] (1 PDB entry)

8. Domain d6wbda1: 6wbd A:11-152 [383533]
   Other proteins in same PDB: d6wbda2, d6wbdb2
   automated match to d1bbua1
   complexed with cl, edo, lys

Details for d6wbda1

PDB Entry: 6wbd, 2.05 Å

PDB Description: crystal structure of lysyl-trna synthetase from stenotrophomonas maltophilia with bound l-lysine

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6wbda1:

Sequence; same for both SEQRES and ATOM records:

>d6wbda1 b.40.4.0 (A:11-152) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
denkliaerreklkalrgqgiaypndfrredfagrlqeefadaetwtaealegngrqvkm
agrlmakrimgkasfaqiqdesgriqlflqgavlgdaytafkgwdvgdiiaveggltrtk
tgelsvkaesirlltkslrplp

Timeline for d6wbda1:

• d6wbda1 first appeared in SCOPe 2.07