Lineage for d2emna_ (2emn A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2164737Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2164743Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (175 PDB entries)
    Uniprot P42212
  8. 2164919Domain d2emna_: 2emn A: [38351]
    mutant

Details for d2emna_

PDB Entry: 2emn (more details), 2.3 Å

PDB Description: green fluorescent protein from aequorea victoria, mutant
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2emna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2emna_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
elftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlx
vqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkg
idfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqntp
igdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d2emna_:

Click to download the PDB-style file with coordinates for d2emna_.
(The format of our PDB-style files is described here.)

Timeline for d2emna_: