Lineage for d6tq3c_ (6tq3 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848615Species Starmerella magnoliae [TaxId:5490] [383415] (3 PDB entries)
  8. 2848622Domain d6tq3c_: 6tq3 C: [383508]
    automated match to d4da9d_

Details for d6tq3c_

PDB Entry: 6tq3 (more details), 2 Å

PDB Description: alcohol dehydrogenase from candida magnoliae dsmz 70638 (adha)
PDB Compounds: (C:) enzyme subunit

SCOPe Domain Sequences for d6tq3c_:

Sequence, based on SEQRES records: (download)

>d6tq3c_ c.2.1.0 (C:) automated matches {Starmerella magnoliae [TaxId: 5490]}
pslnalvtggsrgigeaismqlaaegysvtiasrgleqleavkaklpivkqgqthhvwql
dlsdveaagsfkgaplpassydvfvsnagisqfspiaehadadwqnmltvnltapialtk
avvkaisdkprqtpahiifistglskrgapmvgvysaskagidgfmrslarelgpkginv
ncvspgvtrtsmaegidpsmfdlpingwievdaiadavtylvksknvtgttvsvdngyca

Sequence, based on observed residues (ATOM records): (download)

>d6tq3c_ c.2.1.0 (C:) automated matches {Starmerella magnoliae [TaxId: 5490]}
pslnalvtggsrgigeaismqlaaegysvtiasrgleqleavkaklpivkqgqthhvwql
dlsdveaagsfkgaplpassydvfvsnagisqfspiaehadadwqnmltvnltapialtk
avvkaisdkprqtpahiifistglskrgapmvgvysaskagidgfmrslarelgpkginv
ncvspgvtrtdpsmfdlpingwievdaiadavtylvksknvtgttvsvdngyca

SCOPe Domain Coordinates for d6tq3c_:

Click to download the PDB-style file with coordinates for d6tq3c_.
(The format of our PDB-style files is described here.)

Timeline for d6tq3c_: