Lineage for d1eml__ (1eml -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31413Fold d.22: Fluorescent proteins [54510] (1 superfamily)
  4. 31414Superfamily d.22.1: Fluorescent proteins [54511] (1 family) (S)
  5. 31415Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 31416Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 31417Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (20 PDB entries)
  8. 31433Domain d1eml__: 1eml - [38350]

Details for d1eml__

PDB Entry: 1eml (more details), 2.3 Å

PDB Description: green fluorescent protein from aequorea victoria, mutant

SCOP Domain Sequences for d1eml__:

Sequence, based on SEQRES records: (download)

>d1eml__ d.22.1.1 (-) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
lftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlxv
qcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgi
dfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyqqntpi
gdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Sequence, based on observed residues (ATOM records): (download)

>d1eml__ d.22.1.1 (-) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
lftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlvq
cfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkgid
fkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyqqntpig
dgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOP Domain Coordinates for d1eml__:

Click to download the PDB-style file with coordinates for d1eml__.
(The format of our PDB-style files is described here.)

Timeline for d1eml__: