Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries) |
Domain d6xvqa1: 6xvq A:0-131 [383482] Other proteins in same PDB: d6xvqa2 automated match to d1vyfa_ complexed with cit, plm; mutant |
PDB Entry: 6xvq (more details), 1.8 Å
SCOPe Domain Sequences for d6xvqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xvqa1 b.60.1.0 (A:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]} msnkflgtwklvssenfddymkalgvglatrqlgnlakptviiskkgdiitirtestfkn teisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm kgvvctriyekv
Timeline for d6xvqa1: