Lineage for d1emm__ (1emm -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132152Fold d.22: GFP-like [54510] (1 superfamily)
  4. 132153Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 132154Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 132155Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 132156Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries)
  8. 132174Domain d1emm__: 1emm - [38348]

Details for d1emm__

PDB Entry: 1emm (more details), 2.3 Å

PDB Description: green fluorescent protein from aequorea victoria, mutant

SCOP Domain Sequences for d1emm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emm__ d.22.1.1 (-) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
lftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlsy
gvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielk
gidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqnt
pigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOP Domain Coordinates for d1emm__:

Click to download the PDB-style file with coordinates for d1emm__.
(The format of our PDB-style files is described here.)

Timeline for d1emm__: