Lineage for d1emga_ (1emg A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132152Fold d.22: GFP-like [54510] (1 superfamily)
  4. 132153Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 132154Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 132155Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 132156Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries)
  8. 132172Domain d1emga_: 1emg A: [38346]

Details for d1emga_

PDB Entry: 1emg (more details), 2 Å

PDB Description: green fluorescent protein (65-67 replaced by cro, s65t substitution, q80r)

SCOP Domain Sequences for d1emga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emga_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOP Domain Coordinates for d1emga_:

Click to download the PDB-style file with coordinates for d1emga_.
(The format of our PDB-style files is described here.)

Timeline for d1emga_: