SCOP 1.59: Domain d1bfp__: 1bfp -

Lineage for d1bfp__ (1bfp -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)

6. Protein Green fluorescent protein, GFP [54513] (1 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries)

8. Domain d1bfp__: 1bfp - [38345]

Details for d1bfp__

PDB Entry: 1bfp, 2.1 Å

PDB Description: blue variant of green fluorescent protein

SCOP Domain Sequences for d1bfp__:

Sequence; same for both SEQRES and ATOM records:

>d1bfp__ d.22.1.1 (-) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfshgvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
nrielkgidfkedgnilghkleynfnshnvyimadkqkngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d1bfp__:

• d1bfp__ first appeared (with stable ids) in SCOP 1.55
  
• d1bfp__ appears in SCOP 1.57
  
• d1bfp__ appears in SCOP 1.61
  
• d1bfp__ appears in the current release, SCOPe 2.08, called d1bfpa_