SCOPe 2.05: Domain d1gflb_: 1gfl B:

Lineage for d1gflb_ (1gfl B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (167 PDB entries)
   Uniprot P42212

8. Domain d1gflb_: 1gfl B: [38342]

Details for d1gflb_

PDB Entry: 1gfl, 1.9 Å

PDB Description: structure of green fluorescent protein

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d1gflb_:

Sequence; same for both SEQRES and ATOM records:

>d1gflb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
askgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d1gflb_:

• d1gflb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gflb_ appears in SCOPe 2.04
  
• d1gflb_ appears in SCOPe 2.06
  
• d1gflb_ appears in the current release, SCOPe 2.08