SCOPe 2.05: Domain d1bwza2: 1bwz A:131-274

Lineage for d1bwza2 (1bwz A:131-274)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)

8. Domain d1bwza2: 1bwz A:131-274 [38338]

Details for d1bwza2

PDB Entry: 1bwz, 2.72 Å

PDB Description: diaminopimelate epimerase from hemophilus influenzae

PDB Compounds: (A:) protein (diaminopimelate epimerase)

SCOPe Domain Sequences for d1bwza2:

Sequence; same for both SEQRES and ATOM records:

>d1bwza2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

Timeline for d1bwza2:

• d1bwza2 first appeared (with stable ids) in SCOP 1.55
  
• d1bwza2 appears in SCOPe 2.04
  
• d1bwza2 appears in SCOPe 2.06
  
• d1bwza2 appears in the current release, SCOPe 2.08