Lineage for d1bwza2 (1bwz A:131-274)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501666Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 501667Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 501668Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
  6. 501669Protein Diaminopimelate epimerase [54508] (1 species)
  7. 501670Species Haemophilus influenzae [TaxId:727] [54509] (2 PDB entries)
  8. 501674Domain d1bwza2: 1bwz A:131-274 [38338]

Details for d1bwza2

PDB Entry: 1bwz (more details), 2.72 Å

PDB Description: diaminopimelate epimerase from hemophilus influenzae

SCOP Domain Sequences for d1bwza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwza2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

SCOP Domain Coordinates for d1bwza2:

Click to download the PDB-style file with coordinates for d1bwza2.
(The format of our PDB-style files is described here.)

Timeline for d1bwza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bwza1