Lineage for d1bwza1 (1bwz A:1-130)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643180Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1643181Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1643182Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 1643183Protein Diaminopimelate epimerase [54508] (2 species)
  7. 1643193Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 1643204Domain d1bwza1: 1bwz A:1-130 [38337]

Details for d1bwza1

PDB Entry: 1bwz (more details), 2.72 Å

PDB Description: diaminopimelate epimerase from hemophilus influenzae
PDB Compounds: (A:) protein (diaminopimelate epimerase)

SCOPe Domain Sequences for d1bwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwza1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkdmnqirvnmge
piwepakipf

SCOPe Domain Coordinates for d1bwza1:

Click to download the PDB-style file with coordinates for d1bwza1.
(The format of our PDB-style files is described here.)

Timeline for d1bwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bwza2