Lineage for d1bwza1 (1bwz A:1-130)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.21: Diaminopimelate epimerase [54505] (1 superfamily) Superfamily d.21.1: Diaminopimelate epimerase [54506] (1 family) 
Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) Protein Diaminopimelate epimerase [54508] (1 species) Species Haemophilus influenzae [TaxId:727] [54509] (1 PDB entry) 
Domain d1bwza1: 1bwz A:1-130 [38337]
Details for d1bwza1
PDB Entry: 1bwz (more details), 2.72 Å
PDB Description: diaminopimelate epimerase from hemophilus influenzae
SCOP Domain Sequences for d1bwza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwza1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkdmnqirvnmge
piwepakipf
SCOP Domain Coordinates for d1bwza1:
Click to download the PDB-style file with coordinates for d1bwza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwza1:
- d1bwza1 appears in SCOP 1.57
- d1bwza1 appears in the current release, SCOPe 2.08
View in 3D
