Lineage for d6qbua_ (6qbu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795358Protein Elastase [50536] (4 species)
  7. 2795385Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)
  8. 2795431Domain d6qbua_: 6qbu A: [383366]
    automated match to d1qnja_
    complexed with hvz, mpd, na, po4

Details for d6qbua_

PDB Entry: 6qbu (more details), 1.38 Å

PDB Description: crystal structure of porcine pancreatic elastase (ppe) in complex with the 3-oxo-beta-sultam inhibitor lmc188
PDB Compounds: (A:) Chymotrypsin-like elastase family member 1

SCOPe Domain Sequences for d6qbua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qbua_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d6qbua_:

Click to download the PDB-style file with coordinates for d6qbua_.
(The format of our PDB-style files is described here.)

Timeline for d6qbua_: