Lineage for d2e2ca_ (2e2c A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198745Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1198779Species Clam (Spisula solidissima), E-2C [TaxId:6584] [54504] (1 PDB entry)
  8. 1198780Domain d2e2ca_: 2e2c A: [38336]

Details for d2e2ca_

PDB Entry: 2e2c (more details), 2 Å

PDB Description: e2-c, an ubiquitin conjugating enzyme required for the destruction of mitotic cyclins
PDB Compounds: (A:) ubiquitin conjugating enzyme

SCOPe Domain Sequences for d2e2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]}
mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
pnnasplnaqaadmwsnqteykkvlhekyktaqsdk

SCOPe Domain Coordinates for d2e2ca_:

Click to download the PDB-style file with coordinates for d2e2ca_.
(The format of our PDB-style files is described here.)

Timeline for d2e2ca_: