Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) |
Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) |
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) |
Protein Ubiquitin conjugating enzyme [54497] (12 species) |
Species Clam (Spisula solidissima), E-2C [TaxId:6584] [54504] (1 PDB entry) |
Domain d2e2c__: 2e2c - [38336] |
PDB Entry: 2e2c (more details), 2 Å
SCOP Domain Sequences for d2e2c__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2c__ d.20.1.1 (-) Ubiquitin conjugating enzyme {Clam (Spisula solidissima), E-2C} mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge pnnasplnaqaadmwsnqteykkvlhekyktaqsdk
Timeline for d2e2c__: