SCOPe 2.07: Domain d6r3eb_: 6r3e B:

Lineage for d6r3eb_ (6r3e B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein automated matches [190966] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188600] (18 PDB entries)

8. Domain d6r3eb_: 6r3e B: [383359]
   automated match to d3qkjb_
   complexed with 96h, so4

Details for d6r3eb_

PDB Entry: 6r3e, 2.27 Å

PDB Description: human dnmt3b pwwp domain in complex with triisopropanolamine

PDB Compounds: (B:) DNA (cytosine-5)-methyltransferase 3B,DNA (cytosine-5)-methyltransferase 3B

SCOPe Domain Sequences for d6r3eb_:

Sequence, based on SEQRES records:

>d6r3eb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmle
wahggfkptgieglkpn

Sequence, based on observed residues (ATOM records):

>d6r3eb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpledqlkpmlewahggf
kptgieglkpn

Timeline for d6r3eb_:

• d6r3eb_ is new in SCOPe 2.07-stable
  
• d6r3eb_ appears in the current release, SCOPe 2.08