Lineage for d6r3ya_ (6r3y A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805542Family b.60.1.8: Rv2717c-like [141475] (3 proteins)
    bacterial and plant proteins with a fatty acid binding protein-like fold
    automatically mapped to Pfam PF08768
  6. 2805550Protein Hypothetical protein Rv2717c [141476] (1 species)
  7. 2805551Species Mycobacterium tuberculosis [TaxId:1773] [141477] (3 PDB entries)
    Uniprot O07216 4-164
  8. 2805554Domain d6r3ya_: 6r3y A: [383356]
    automated match to d2fr2a1
    complexed with cyn, hem

Details for d6r3ya_

PDB Entry: 6r3y (more details), 1.6 Å

PDB Description: m.tuberculosis nitrobindin with a cyanide molecule coordinated to the heme iron atom
PDB Compounds: (A:) UPF0678 fatty acid-binding protein-like protein ERS007657_00996

SCOPe Domain Sequences for d6r3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r3ya_ b.60.1.8 (A:) Hypothetical protein Rv2717c {Mycobacterium tuberculosis [TaxId: 1773]}
dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp
lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak
evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr

SCOPe Domain Coordinates for d6r3ya_:

Click to download the PDB-style file with coordinates for d6r3ya_.
(The format of our PDB-style files is described here.)

Timeline for d6r3ya_: