Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (22 PDB entries) identical sequence in many other species |
Domain d1u9ba_: 1u9b A: [38334] |
PDB Entry: 1u9b (more details), 2 Å
SCOPe Domain Sequences for d1u9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9ba_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} nmsgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfk lrmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqel lnepniqdpaqaeaytiycqnrveyekrvraqakkfaps
Timeline for d1u9ba_: