Lineage for d6oaid_ (6oai D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781109Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)
  8. 2781127Domain d6oaid_: 6oai D: [383336]
    automated match to d5vkia_

Details for d6oaid_

PDB Entry: 6oai (more details), 1.9 Å

PDB Description: crystal structure of p[6] rotavirus vp8* complexed with lnfpi
PDB Compounds: (D:) Protease-sensitive outer capsid protein

SCOPe Domain Sequences for d6oaid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oaid_ b.29.1.0 (D:) automated matches {Human rotavirus a [TaxId: 10941]}
ldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
tkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetphat
tdysstsnlsevetvihvefyiiprsqeskcseyintg

SCOPe Domain Coordinates for d6oaid_:

Click to download the PDB-style file with coordinates for d6oaid_.
(The format of our PDB-style files is described here.)

Timeline for d6oaid_: