Lineage for d6oaia_ (6oai A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375499Species Human rotavirus a [TaxId:10941] [187643] (13 PDB entries)
  8. 3083266Domain d6oaia_: 6oai A: [383328]
    automated match to d5vkia_
    complexed with m2j

Details for d6oaia_

PDB Entry: 6oai (more details), 1.9 Å

PDB Description: crystal structure of p[6] rotavirus vp8* complexed with lnfpi
PDB Compounds: (A:) Protease-sensitive outer capsid protein

SCOPe Domain Sequences for d6oaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oaia_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
ldgpyqptnfkppndywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
tkqitvenntnkwkffemfrsnvsaefqhkrtltsdtklagfmkfynsvwtfhgetphat
tdysstsnlsevetvihvefyiiprsqeskcseyintgl

SCOPe Domain Coordinates for d6oaia_:

Click to download the PDB-style file with coordinates for d6oaia_.
(The format of our PDB-style files is described here.)

Timeline for d6oaia_:

  • d6oaia_ is new in SCOPe 2.07-stable