Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (6 species) |
Species Nicotiana benthamiana [TaxId:4100] [383320] (1 PDB entry) |
Domain d6l26a_: 6l26 A: [383321] automated match to d1emcc_ complexed with cro, d3o, dod; mutant |
PDB Entry: 6l26 (more details), 1.44 Å
SCOPe Domain Sequences for d6l26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l26a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Nicotiana benthamiana [TaxId: 4100]} mgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfisttgklpvpwptlvt tlgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr ielkgidfkedgnilghkleynynshnvyimadkqkqgikvnfktrhniedgsvqladhy qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
Timeline for d6l26a_: