Lineage for d6l26a_ (6l26 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2940192Species Nicotiana benthamiana [TaxId:4100] [383320] (1 PDB entry)
  8. 2940193Domain d6l26a_: 6l26 A: [383321]
    automated match to d1emcc_
    complexed with cro, d3o, dod; mutant

Details for d6l26a_

PDB Entry: 6l26 (more details), 1.44 Å

PDB Description: neutron crystal structure of the mutant green fluorescent protein (egfp)
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d6l26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l26a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Nicotiana benthamiana [TaxId: 4100]}
mgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfisttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkqgikvnfktrhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d6l26a_:

Click to download the PDB-style file with coordinates for d6l26a_.
(The format of our PDB-style files is described here.)

Timeline for d6l26a_: