SCOP 1.59: Domain d1fbvc_: 1fbv C:

Lineage for d1fbvc_ (1fbv C:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)

4. Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family)

5. Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme [54497] (13 species)

7. Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries)

8. Domain d1fbvc_: 1fbv C: [38332]
   Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva3, d1fbva4

Details for d1fbvc_

PDB Entry: 1fbv, 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

SCOP Domain Sequences for d1fbvc_:

Sequence; same for both SEQRES and ATOM records:

>d1fbvc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubch7}
srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
dlaeeyskdrkkfcknaeeftkky

Timeline for d1fbvc_:

• d1fbvc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbvc_ appears in SCOP 1.57
  
• d1fbvc_ appears in SCOP 1.61
  
• d1fbvc_ appears in the current release, SCOPe 2.08