SCOPe 2.05: Domain d1c4zd_: 1c4z D:

Lineage for d1c4zd_ (1c4z D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries)

8. Domain d1c4zd_: 1c4z D: [38331]
   Other proteins in same PDB: d1c4za_, d1c4zb_, d1c4zc_

Details for d1c4zd_

PDB Entry: 1c4z, 2.6 Å

PDB Description: structure of an e6ap-ubch7 complex: insights into the ubiquitination pathway

PDB Compounds: (D:) ubiquitin conjugating enzyme e2

SCOPe Domain Sequences for d1c4zd_:

Sequence; same for both SEQRES and ATOM records:

>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]}
srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
dlaeeyskdrkkfcknaeeftkky

Timeline for d1c4zd_:

• d1c4zd_ first appeared (with stable ids) in SCOP 1.55
  
• d1c4zd_ appears in SCOPe 2.04
  
• d1c4zd_ appears in SCOPe 2.06
  
• d1c4zd_ appears in the current release, SCOPe 2.08