Lineage for d1c4zd_ (1c4z D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31383Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)
  4. 31384Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) (S)
  5. 31385Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)
  6. 31386Protein Ubiquitin conjugating enzyme [54497] (7 species)
  7. 31403Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries)
  8. 31404Domain d1c4zd_: 1c4z D: [38331]
    Other proteins in same PDB: d1c4za_, d1c4zb_, d1c4zc_

Details for d1c4zd_

PDB Entry: 1c4z (more details), 2.6 Å

PDB Description: structure of an e6ap-ubch7 complex: insights into the ubiquitination pathway

SCOP Domain Sequences for d1c4zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubch7}
srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
dlaeeyskdrkkfcknaeeftkky

SCOP Domain Coordinates for d1c4zd_:

Click to download the PDB-style file with coordinates for d1c4zd_.
(The format of our PDB-style files is described here.)

Timeline for d1c4zd_: