![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) |
![]() | Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) ![]() |
![]() | Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) |
![]() | Protein Ubiquitin conjugating enzyme [54497] (7 species) |
![]() | Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries) |
![]() | Domain d1c4zd_: 1c4z D: [38331] Other proteins in same PDB: d1c4za_, d1c4zb_, d1c4zc_ |
PDB Entry: 1c4z (more details), 2.6 Å
SCOP Domain Sequences for d1c4zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubch7} srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra dlaeeyskdrkkfcknaeeftkky
Timeline for d1c4zd_: