Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries) |
Domain d1c4zd_: 1c4z D: [38331] Other proteins in same PDB: d1c4za_, d1c4zb_, d1c4zc_ |
PDB Entry: 1c4z (more details), 2.6 Å
SCOPe Domain Sequences for d1c4zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra dlaeeyskdrkkfcknaeeftkky
Timeline for d1c4zd_: