Lineage for d1c4zd_ (1c4z D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939213Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries)
  8. 2939214Domain d1c4zd_: 1c4z D: [38331]
    Other proteins in same PDB: d1c4za_, d1c4zb_, d1c4zc_

Details for d1c4zd_

PDB Entry: 1c4z (more details), 2.6 Å

PDB Description: structure of an e6ap-ubch7 complex: insights into the ubiquitination pathway
PDB Compounds: (D:) ubiquitin conjugating enzyme e2

SCOPe Domain Sequences for d1c4zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]}
srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
dlaeeyskdrkkfcknaeeftkky

SCOPe Domain Coordinates for d1c4zd_:

Click to download the PDB-style file with coordinates for d1c4zd_.
(The format of our PDB-style files is described here.)

Timeline for d1c4zd_: